PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_11080
Common NameKK1_011404
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family CPP
Protein Properties Length: 638aa    MW: 71222.6 Da    PI: 8.0139
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_11080genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR46.38.4e-15187225241
            TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                    ++k+CnCk+s+Clk+YCeCfaag +C+  C+C +C+N+ +
  C.cajan_11080 187 KQKQCNCKNSRCLKLYCECFAAGIYCDG-CNCVNCHNNVD 225
                    89**************************.********986 PP

2TCR50.83.4e-16269308140
            TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                    k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  C.cajan_11080 269 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 308
                    589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.6E-18186226IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.731187309IPR005172CRC domain
PfamPF036387.6E-12188223IPR005172CRC domain
SMARTSM011148.4E-20269310IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.3E-12272307IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
KMEQSETTFD LAPRKLARQL DFTAACGDPS HLKLPPPTPL PQSPCQTLQP PPPPHSPLQL  60
QLDLHPPGQR SWLYSRQRTP EVRFWRRVFL WKKIKNVSSN HFLINHFCNH KCFEIGLLVS  120
ACNGAHHYLF EGGYNHLNCG IINLLLNKGL EIVFYLFTLL NFASQKLESP RSQPRCYVEL  180
KDTTPKKQKQ CNCKNSRCLK LYCECFAAGI YCDGCNCVNC HNNVDNEAAR QEAVGITLER  240
NPNAFRPKIA SSPQEPRDFK ECEIQVIGKH NKGCHCKKSG CLKKYCECFQ ANILCSENCK  300
CMDCKNFEGS DERRAILHKE YNLVHIKQAS NAANTGVVGS SGYGTRLTPK KRKIQEMFPG  360
KSAMDQTVNM IAQYQQEIDH MASSPSSLSD SFVSDPANTR FSGSSRSTYR SVLADVLQSQ  420
NVKNLCSLFV VLSRVAANPN KEMRVDQQTK SGNVESSVAL SAKSLQETRD VNRPVSDDGM  480
NKDEVDIANC NRPLSPDTAA LMCDEEDAML FGNNSANGVA CNNTYQNMIQ KSFNSDGCTD  540
VYGEQERLIL TKFLDVLRGL VTHGSIKETM CYSSSKKGEI NEKKPADNSN IGAETDVESE  600
KGTDRNCITI YPIPSVTKMS QTNYSITNGH GNNDHSLT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-101AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006581438.10.0PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X1
SwissprotQ9SZD11e-121TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A151TDQ80.0A0A151TDQ8_CAJCA; Protein lin-54 (Fragment)
STRINGGLYMA06G08774.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF151511113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-103Tesmin/TSO1-like CXC domain-containing protein